Lineage for d1i9wa2 (1i9w A:1-292)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886497Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 886498Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 886499Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 886525Protein Fusion glycoprotein E1 [75656] (1 species)
  7. 886526Species Semliki forest virus [TaxId:11033] [75657] (3 PDB entries)
  8. 886528Domain d1i9wa2: 1i9w A:1-292 [71164]
    Other proteins in same PDB: d1i9wa1

Details for d1i9wa2

PDB Entry: 1i9w (more details), 3 Å

PDB Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus
PDB Compounds: (A:) fusion protein e1

SCOP Domain Sequences for d1i9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9wa2 f.10.1.1 (A:1-292) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

SCOP Domain Coordinates for d1i9wa2:

Click to download the PDB-style file with coordinates for d1i9wa2.
(The format of our PDB-style files is described here.)

Timeline for d1i9wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i9wa1