Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins) |
Protein Fusion glycoprotein E1 [75656] (1 species) |
Species Semliki forest virus [TaxId:11033] [75657] (1 PDB entry) |
Domain d1i9wa2: 1i9w A:1-292 [71164] Other proteins in same PDB: d1i9wa1 |
PDB Entry: 1i9w (more details), 3 Å
SCOP Domain Sequences for d1i9wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9wa2 f.10.1.1 (A:1-292) Fusion glycoprotein E1 {Semliki forest virus} yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive
Timeline for d1i9wa2: