SCOPe 2.01: Domain d1i60a_: 1i60 A:

Lineage for d1i60a_ (1i60 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.4: IolI-like [75090] (3 proteins)

6. Protein Hypothetical protein IolI [75091] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75092] (2 PDB entries)

8. Domain d1i60a_: 1i60 A: [71118]
   Structural genomics

Details for d1i60a_

PDB Entry: 1i60, 1.6 Å

PDB Description: structural genomics, ioli protein

PDB Compounds: (A:) ioli protein

SCOPe Domain Sequences for d1i60a_:

Sequence; same for both SEQRES and ATOM records:

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]}
mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi
kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks
svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha
mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs
dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm

Timeline for d1i60a_:

• d1i60a_ first appeared in SCOP 1.61
  
• d1i60a_ appears in SCOP 1.75
  
• d1i60a_ appears in SCOPe 2.02
  
• d1i60a_ appears in the current release, SCOPe 2.08