Class a: All alpha proteins [46456] (258 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.8: Conserved hypothetical protein MTH1747 [74762] (1 protein) |
Protein Conserved hypothetical protein MTH1747 [74763] (1 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [74764] (1 PDB entry) |
Domain d1i36b1: 1i36 B:153-264 [71110] Other proteins in same PDB: d1i36a2, d1i36b2 complexed with nap; mutant |
PDB Entry: 1i36 (more details), 2 Å
SCOP Domain Sequences for d1i36b1:
Sequence, based on SEQRES records: (download)
>d1i36b1 a.100.1.8 (B:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} gdasaikmlrssytkgvsallwetltaahrlgleedvlemleytegndfresaisrlkss ciharrryeemkevqdmlaevidpvmptciirifdklkdvkvsadarlqgca
>d1i36b1 a.100.1.8 (B:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} gdasaikmlrssytkgvsallwetltaahrlgleedvlemleytegndfresaisrlkss ciharrryeemkevqdmlaevidpvmptciirifdklkdarlqgca
Timeline for d1i36b1: