SCOP 1.73: Domain d1i36b1: 1i36 B:153-264

Lineage for d1i36b1 (1i36 B:153-264)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.8: Conserved hypothetical protein MTH1747 [74762] (1 protein)

6. Protein Conserved hypothetical protein MTH1747 [74763] (1 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [74764] (1 PDB entry)

8. Domain d1i36b1: 1i36 B:153-264 [71110]
   Other proteins in same PDB: d1i36a2, d1i36b2
   complexed with nap; mutant

Details for d1i36b1

PDB Entry: 1i36, 2 Å

PDB Description: structure of conserved protein mth1747 of unknown function reveals structural similarity with 3-hydroxyacid dehydrogenases

PDB Compounds: (B:) conserved hypothetical protein mth1747

SCOP Domain Sequences for d1i36b1:

Sequence, based on SEQRES records:

>d1i36b1 a.100.1.8 (B:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
gdasaikmlrssytkgvsallwetltaahrlgleedvlemleytegndfresaisrlkss
ciharrryeemkevqdmlaevidpvmptciirifdklkdvkvsadarlqgca

Sequence, based on observed residues (ATOM records):

>d1i36b1 a.100.1.8 (B:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
gdasaikmlrssytkgvsallwetltaahrlgleedvlemleytegndfresaisrlkss
ciharrryeemkevqdmlaevidpvmptciirifdklkdarlqgca

Timeline for d1i36b1:

• d1i36b1 first appeared in SCOP 1.61
  
• d1i36b1 appears in SCOP 1.71
  
• d1i36b1 appears in SCOP 1.75
  
• d1i36b1 appears in the current release, SCOPe 2.08