Lineage for d1i36b1 (1i36 B:153-264)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155193Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 155194Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (8 families) (S)
  5. 155257Family a.100.1.8: Conserved hypothetical protein MTH1747 [74762] (1 protein)
  6. 155258Protein Conserved hypothetical protein MTH1747 [74763] (1 species)
  7. 155259Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [74764] (1 PDB entry)
  8. 155261Domain d1i36b1: 1i36 B:153-264 [71110]
    Other proteins in same PDB: d1i36a2, d1i36b2

Details for d1i36b1

PDB Entry: 1i36 (more details), 2 Å

PDB Description: structure of conserved protein mth1747 of unknown function reveals structural similarity with 3-hydroxyacid dehydrogenases

SCOP Domain Sequences for d1i36b1:

Sequence, based on SEQRES records: (download)

>d1i36b1 a.100.1.8 (B:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum}
gdasaikmlrssytkgvsallwetltaahrlgleedvlemleytegndfresaisrlkss
ciharrryeemkevqdmlaevidpvmptciirifdklkdvkvsadarlqgca

Sequence, based on observed residues (ATOM records): (download)

>d1i36b1 a.100.1.8 (B:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum}
gdasaikmlrssytkgvsallwetltaahrlgleedvlemleytegndfresaisrlkss
ciharrryeemkevqdmlaevidpvmptciirifdklkdarlqgca

SCOP Domain Coordinates for d1i36b1:

Click to download the PDB-style file with coordinates for d1i36b1.
(The format of our PDB-style files is described here.)

Timeline for d1i36b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i36b2