Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins) |
Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
Domain d1htoc2: 1hto C:101-468 [70992] Other proteins in same PDB: d1htoa1, d1htob1, d1htoc1, d1htod1, d1htoe1, d1htof1, d1htog1, d1htoh1, d1htoi1, d1htoj1, d1htok1, d1htol1, d1htom1, d1hton1, d1htoo1, d1htop1, d1htoq1, d1htor1, d1htos1, d1htot1, d1htou1, d1htov1, d1htow1, d1htox1 complexed with amp, cit, mn |
PDB Entry: 1hto (more details), 2.4 Å
SCOPe Domain Sequences for d1htoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htoc2 d.128.1.1 (C:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d1htoc2:
View in 3D Domains from other chains: (mouse over for more information) d1htoa1, d1htoa2, d1htob1, d1htob2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2 |