PDB entry 1hto

View 1hto on RCSB PDB site
Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
Class: ligase
Keywords: glutamine synthetase, Mycobacterium tuberculosis, Citrate, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, LIGASE
Deposited on 2001-01-01, released 2002-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoa1, d1htoa2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htob1, d1htob2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoc1, d1htoc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htod1, d1htod2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoe1, d1htoe2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htof1, d1htof2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htog1, d1htog2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoh1, d1htoh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoi1, d1htoi2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoj1, d1htoj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htok1, d1htok2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htol1, d1htol2
  • Chain 'M':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htom1, d1htom2
  • Chain 'N':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hton1, d1hton2
  • Chain 'O':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoo1, d1htoo2
  • Chain 'P':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htop1, d1htop2
  • Chain 'Q':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htoq1, d1htoq2
  • Chain 'R':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htor1, d1htor2
  • Chain 'S':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htos1, d1htos2
  • Chain 'T':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htot1, d1htot2
  • Chain 'U':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htou1, d1htou2
  • Chain 'V':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htov1, d1htov2
  • Chain 'W':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htow1, d1htow2
  • Chain 'X':
    Compound: glutamine synthetase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1htox1, d1htox2
  • Heterogens: MN, AMP, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoA (A:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoB (B:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoC (C:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoD (D:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoE (E:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoF (F:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoG (G:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoH (H:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoI (I:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoJ (J:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoK (K:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoL (L:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoM (M:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoN (N:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoO (O:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoP (P:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoQ (Q:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoR (R:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoS (S:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoT (T:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoU (U:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoV (V:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoW (W:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htoX (X:)
    tektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgf
    qsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylis
    tgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvr
    hkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaadd
    mqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdt
    arhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpk
    akrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtpt
    qlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv