![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein Phycocyanin beta subunit [88940] (8 species) |
![]() | Species Spirulina platensis [TaxId:118562] [88952] (2 PDB entries) |
![]() | Domain d1ha7x_: 1ha7 X: [70958] Other proteins in same PDB: d1ha7a_, d1ha7c_, d1ha7e_, d1ha7g_, d1ha7i_, d1ha7k_, d1ha7m_, d1ha7o_, d1ha7q_, d1ha7s_, d1ha7u_, d1ha7w_ complexed with cyc |
PDB Entry: 1ha7 (more details), 2.2 Å
SCOPe Domain Sequences for d1ha7x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha7x_ a.1.1.3 (X:) Phycocyanin beta subunit {Spirulina platensis [TaxId: 118562]} mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldavnritsnastivsnaarslf aeqpqliapggnaytsrrmaaclrdmeiilryvtyavfagdasvledrclnglretylal gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
Timeline for d1ha7x_: