Lineage for d1ha7r_ (1ha7 R:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 759877Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 759956Protein Phycocyanin beta subunit [88940] (6 species)
  7. 759966Species Spirulina platensis [TaxId:118562] [88952] (2 PDB entries)
  8. 759975Domain d1ha7r_: 1ha7 R: [70952]
    Other proteins in same PDB: d1ha7a_, d1ha7c_, d1ha7e_, d1ha7g_, d1ha7i_, d1ha7k_, d1ha7m_, d1ha7o_, d1ha7q_, d1ha7s_, d1ha7u_, d1ha7w_

Details for d1ha7r_

PDB Entry: 1ha7 (more details), 2.2 Å

PDB Description: structure of a light-harvesting phycobiliprotein, c-phycocyanin from spirulina platensis at 2.2a resolution
PDB Compounds: (R:) C-phycocyanin beta chain

SCOP Domain Sequences for d1ha7r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha7r_ a.1.1.3 (R:) Phycocyanin beta subunit {Spirulina platensis [TaxId: 118562]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldavnritsnastivsnaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs

SCOP Domain Coordinates for d1ha7r_:

Click to download the PDB-style file with coordinates for d1ha7r_.
(The format of our PDB-style files is described here.)

Timeline for d1ha7r_: