![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
![]() | Protein PDC-109, collagen-binding type II domain [57460] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57461] (2 PDB entries) |
![]() | Domain d1h8pa2: 1h8p A:68-109 [70917] complexed with pc |
PDB Entry: 1h8p (more details), 1.82 Å
SCOPe Domain Sequences for d1h8pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8pa2 g.14.1.2 (A:68-109) PDC-109, collagen-binding type II domain {Cow (Bos taurus) [TaxId: 9913]} kcvfpfiyggkkyetctkigsmwmswcslspnydkdrawkyc
Timeline for d1h8pa2: