Lineage for d1h5va_ (1h5v A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474606Protein Endoglucanase Cel5a [51499] (3 species)
  7. 474607Species Bacillus agaradhaerens [TaxId:76935] [51500] (19 PDB entries)
  8. 474613Domain d1h5va_: 1h5v A: [70898]

Details for d1h5va_

PDB Entry: 1h5v (more details), 1.1 Å

PDB Description: thiopentasaccharide complex of the endoglucanase cel5a from bacillus agaradharens at 1.1 a resolution in the tetragonal crystal form

SCOP Domain Sequences for d1h5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5va_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
a

SCOP Domain Coordinates for d1h5va_:

Click to download the PDB-style file with coordinates for d1h5va_.
(The format of our PDB-style files is described here.)

Timeline for d1h5va_: