Lineage for d1h55a_ (1h55 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541091Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541092Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 541093Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 541238Protein Plant peroxidase [48125] (6 species)
  7. 541241Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)
  8. 541250Domain d1h55a_: 1h55 A: [70877]
    complexed with act, ca, hem, oxo

Details for d1h55a_

PDB Entry: 1h55 (more details), 1.61 Å

PDB Description: structure of horseradish peroxidase c1a compound ii

SCOP Domain Sequences for d1h55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h55a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOP Domain Coordinates for d1h55a_:

Click to download the PDB-style file with coordinates for d1h55a_.
(The format of our PDB-style files is described here.)

Timeline for d1h55a_: