Lineage for d1h55a_ (1h55 A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) 
Family a.93.1.1: CCP-like [48114] (6 proteins) Protein Plant peroxidase [48125] (6 species) 
Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (21 PDB entries) 
Domain d1h55a_: 1h55 A: [70877]
Details for d1h55a_
PDB Entry: 1h55 (more details), 1.61 Å
PDB Description: structure of horseradish peroxidase c1a compound ii
SCOP Domain Sequences for d1h55a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h55a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns
SCOP Domain Coordinates for d1h55a_:
Click to download the PDB-style file with coordinates for d1h55a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h55a_:
- d1h55a_ is new in SCOP 1.61
- d1h55a_ appears in SCOP 1.63
- d1h55a_ appears in the current release, SCOPe 2.08
View in 3D