Lineage for d1h4hd_ (1h4h D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308405Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1308450Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1308462Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)
  8. 1308472Domain d1h4hd_: 1h4h D: [70868]
    mutant

Details for d1h4hd_

PDB Entry: 1h4h (more details), 1.9 Å

PDB Description: oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre
PDB Compounds: (D:) xylanase

SCOPe Domain Sequences for d1h4hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4hd_ b.29.1.11 (D:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplvayyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnplst

SCOPe Domain Coordinates for d1h4hd_:

Click to download the PDB-style file with coordinates for d1h4hd_.
(The format of our PDB-style files is described here.)

Timeline for d1h4hd_: