SCOP 1.65: Domain d1h4hd_: 1h4h D:

Lineage for d1h4hd_ (1h4h D:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (15 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)

8. Domain d1h4hd_: 1h4h D: [70868]
   complexed with pca, xys; mutant

Details for d1h4hd_

PDB Entry: 1h4h, 1.9 Å

PDB Description: oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre

SCOP Domain Sequences for d1h4hd_:

Sequence; same for both SEQRES and ATOM records:

>d1h4hd_ b.29.1.11 (D:) Xylanase II {Bacillus agaradhaerens}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplvayyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnplst

Timeline for d1h4hd_:

• d1h4hd_ first appeared in SCOP 1.61
  
• d1h4hd_ appears in SCOP 1.63
  
• d1h4hd_ appears in SCOP 1.67
  
• d1h4hd_ appears in the current release, SCOPe 2.08