Lineage for d1h1nb_ (1h1n B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.3: beta-glycanases [51487] (14 proteins) 
Protein Endocellulase EngI [75066] (1 species) Species Thermoascus aurantiacus [TaxId:5087] [75067] (2 PDB entries) 
Domain d1h1nb_: 1h1n B: [70856]
Details for d1h1nb_
PDB Entry: 1h1n (more details), 1.12 Å
PDB Description: atomic resolution structure of the major endoglucanase from thermoascus aurantiacus
SCOP Domain Sequences for d1h1nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1nb_ c.1.8.3 (B:) Endocellulase EngI {Thermoascus aurantiacus}
kvfqwfgsnesgaefgsqnlpgvegkdyiwpdpntidtliskgmnifrvpfmmerlvpns
mtgspdpnyladliatvnaitqkgayavvdphnygryynsiisspsdfetfwktvasqfa
snplvifdtdneyhdmdqtlvlnlnqaaidgirsagatsqyifvegnswtgawtwtnvnd
nmksltdpsdkiiyemhqyldsdgsgtsatcvsstigqeritsatqwlrangkkgiigef
aggadnvcetaitgmldymaqntdvwtgaiwwaagpwwgdyifsmepdngiayqqilpil
tpyl
SCOP Domain Coordinates for d1h1nb_:
Click to download the PDB-style file with coordinates for d1h1nb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h1nb_:
- d1h1nb_ is new in SCOP 1.61
- d1h1nb_ appears in SCOP 1.63
- d1h1nb_ appears in the current release, SCOPe 2.08
View in 3D
