![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.15.1: BRCT domain [52113] (4 families) ![]() |
![]() | Family c.15.1.4: 53BP1 [75148] (1 protein) |
![]() | Protein 53BP1 [75149] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries) |
![]() | Domain d1gzhd2: 1gzh D:1867-1970 [70812] Other proteins in same PDB: d1gzha_, d1gzhc_ |
PDB Entry: 1gzh (more details), 2.6 Å
SCOP Domain Sequences for d1gzhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzhd2 c.15.1.4 (D:1867-1970) 53BP1 {Human (Homo sapiens)} npfqnlkvllvsdqqqnflelwseilmtggaasvkqhhssahnkdialgvfdvvvtdpsc pasvlkcaealqlpvvsqewviqclivgerigfkqhpkykhdyv
Timeline for d1gzhd2:
![]() Domains from other chains: (mouse over for more information) d1gzha_, d1gzhb1, d1gzhb2, d1gzhc_ |