Lineage for d1gzhd2 (1gzh D:1867-1970)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480638Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 480639Superfamily c.15.1: BRCT domain [52113] (4 families) (S)
  5. 480679Family c.15.1.4: 53BP1 [75148] (1 protein)
  6. 480680Protein 53BP1 [75149] (1 species)
  7. 480681Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries)
  8. 480689Domain d1gzhd2: 1gzh D:1867-1970 [70812]
    Other proteins in same PDB: d1gzha_, d1gzhc_

Details for d1gzhd2

PDB Entry: 1gzh (more details), 2.6 Å

PDB Description: Crystal structure of the BRCT domains of human 53BP1 bound to the p53 tumor supressor

SCOP Domain Sequences for d1gzhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzhd2 c.15.1.4 (D:1867-1970) 53BP1 {Human (Homo sapiens)}
npfqnlkvllvsdqqqnflelwseilmtggaasvkqhhssahnkdialgvfdvvvtdpsc
pasvlkcaealqlpvvsqewviqclivgerigfkqhpkykhdyv

SCOP Domain Coordinates for d1gzhd2:

Click to download the PDB-style file with coordinates for d1gzhd2.
(The format of our PDB-style files is described here.)

Timeline for d1gzhd2: