SCOP 1.69: Domain d1gzhc_: 1gzh C:

Lineage for d1gzhc_ (1gzh C:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (6 PDB entries)

8. Domain d1gzhc_: 1gzh C: [70810]
   Other proteins in same PDB: d1gzhb1, d1gzhb2, d1gzhd1, d1gzhd2

Details for d1gzhc_

PDB Entry: 1gzh, 2.6 Å

PDB Description: Crystal structure of the BRCT domains of human 53BP1 bound to the p53 tumor supressor

SCOP Domain Sequences for d1gzhc_:

Sequence; same for both SEQRES and ATOM records:

>d1gzhc_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens)}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
cacpgrdrrteeenlr

Timeline for d1gzhc_:

• d1gzhc_ first appeared in SCOP 1.61
  
• d1gzhc_ appears in SCOP 1.67
  
• d1gzhc_ appears in SCOP 1.71
  
• d1gzhc_ appears in the current release, SCOPe 2.08