Lineage for d1gywb_ (1gyw B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298992Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 1299014Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
    automatically mapped to Pfam PF02883
  6. 1299024Protein Gamma1-adaptin domain [74858] (1 species)
  7. 1299025Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)
  8. 1299031Domain d1gywb_: 1gyw B: [70792]
    complexed with cl; mutant

Details for d1gywb_

PDB Entry: 1gyw (more details), 2.4 Å

PDB Description: gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant
PDB Compounds: (B:) adapter-related protein complex 1 gamma 1 subunit

SCOPe Domain Sequences for d1gywb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gywb_ b.1.10.2 (B:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
plfndiapgipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqadv
pktfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevn
nfppqswq

SCOPe Domain Coordinates for d1gywb_:

Click to download the PDB-style file with coordinates for d1gywb_.
(The format of our PDB-style files is described here.)

Timeline for d1gywb_: