Lineage for d1gywb_ (1gyw B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (2 families) 
Family b.1.10.2: Gamma1-adaptin ear domain [74857] (1 protein) Protein Gamma1-adaptin ear domain [74858] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries) 
Domain d1gywb_: 1gyw B: [70792]
Details for d1gywb_
PDB Entry: 1gyw (more details), 2.4 Å
PDB Description: gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant
SCOP Domain Sequences for d1gywb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gywb_ b.1.10.2 (B:) Gamma1-adaptin ear domain {Human (Homo sapiens)}
plfndiapgipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqadv
pktfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevn
nfppqswq
SCOP Domain Coordinates for d1gywb_:
Click to download the PDB-style file with coordinates for d1gywb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gywb_:
- d1gywb_ is new in SCOP 1.61
- d1gywb_ appears in SCOP 1.63
- d1gywb_ appears in the current release, SCOPe 2.08
View in 3D
