Lineage for d1gyua_ (1gyu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769708Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 1769730Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
    automatically mapped to Pfam PF02883
  6. 1769740Protein Gamma1-adaptin domain [74858] (1 species)
  7. 1769741Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)
  8. 1769743Domain d1gyua_: 1gyu A: [70789]

Details for d1gyua_

PDB Entry: 1gyu (more details), 1.81 Å

PDB Description: gamma-adaptin appendage domain from clathrin adaptor ap1
PDB Compounds: (A:) adapter-related protein complex 1 gamma 1 subunit

SCOPe Domain Sequences for d1gyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyua_ b.1.10.2 (A:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

SCOPe Domain Coordinates for d1gyua_:

Click to download the PDB-style file with coordinates for d1gyua_.
(The format of our PDB-style files is described here.)

Timeline for d1gyua_: