Lineage for d1gyua_ (1gyu A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161622Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (2 families) (S)
  5. 161638Family b.1.10.2: Gamma1-adaptin ear domain [74857] (1 protein)
  6. 161639Protein Gamma1-adaptin ear domain [74858] (1 species)
  7. 161640Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)
  8. 161642Domain d1gyua_: 1gyu A: [70789]

Details for d1gyua_

PDB Entry: 1gyu (more details), 1.81 Å

PDB Description: gamma-adaptin appendage domain from clathrin adaptor ap1

SCOP Domain Sequences for d1gyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyua_ b.1.10.2 (A:) Gamma1-adaptin ear domain {Human (Homo sapiens)}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

SCOP Domain Coordinates for d1gyua_:

Click to download the PDB-style file with coordinates for d1gyua_.
(The format of our PDB-style files is described here.)

Timeline for d1gyua_: