Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.2: NTF2-like [54431] (6 proteins) |
Protein Nuclear transport factor-2 (NTF2) [54432] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75374] (2 PDB entries) |
Domain d1gy7b_: 1gy7 B: [70739] mutant |
PDB Entry: 1gy7 (more details), 1.6 Å
SCOPe Domain Sequences for d1gy7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gy7b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldfntlaqnftqfyynqfdtdrsqlgnlyrnesmltfetsqlqgakdiveklvslpfqkv qhrittldaqpaspygdvlvmitgdllideeqnpqrfsqvfhlipdgnsyyvfndifrln ys
Timeline for d1gy7b_: