Lineage for d1gxha_ (1gxh A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086307Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1086395Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 1086396Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 1086416Protein ImmE8 (Im8) [47349] (1 species)
  7. 1086417Species Escherichia coli [TaxId:562] [47350] (2 PDB entries)
  8. 1086419Domain d1gxha_: 1gxh A: [70706]

Details for d1gxha_

PDB Entry: 1gxh (more details)

PDB Description: colicin e8 dnase immunity protein: im8
PDB Compounds: (A:) colicin e8 immunity protein

SCOPe Domain Sequences for d1gxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxha_ a.28.2.1 (A:) ImmE8 (Im8) {Escherichia coli [TaxId: 562]}
melknsisdytetefkkiiediincegdekkqddnlehfisvtehpsgsdliyypegnnd
gspeavikeikewraangksgfkqg

SCOPe Domain Coordinates for d1gxha_:

Click to download the PDB-style file with coordinates for d1gxha_.
(The format of our PDB-style files is described here.)

Timeline for d1gxha_: