Lineage for d1gxda5 (1gxd A:249-308)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890943Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 890944Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 891041Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 891050Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
    duplication: tandem repeat of three modules inserted in the catalytic domain
  7. 891051Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)
  8. 891068Domain d1gxda5: 1gxd A:249-308 [70695]
    Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdc_, d1gxdd_

Details for d1gxda5

PDB Entry: 1gxd (more details), 3.1 Å

PDB Description: prommp-2/timp-2 complex
PDB Compounds: (A:) 72 kda type IV collagenase

SCOP Domain Sequences for d1gxda5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxda5 g.14.1.2 (A:249-308) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]}
alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetam

SCOP Domain Coordinates for d1gxda5:

Click to download the PDB-style file with coordinates for d1gxda5.
(The format of our PDB-style files is described here.)

Timeline for d1gxda5: