![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
![]() | Protein Gelatinase A (MMP-2) type II modules [57464] (1 species) duplication: tandem repeat of three modules inserted in the catalytic domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries) |
![]() | Domain d1gxda5: 1gxd A:249-308 [70695] Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdc_, d1gxdd_ complexed with ca, so4, zn |
PDB Entry: 1gxd (more details), 3.1 Å
SCOPe Domain Sequences for d1gxda5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxda5 g.14.1.2 (A:249-308) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]} alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetam
Timeline for d1gxda5: