| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
| Protein Class tau GST [81354] (2 species) |
| Species Wheat (Triticum tauschii l.) [74726] (1 PDB entry) |
| Domain d1gwca1: 1gwc A:87-224 [70660] Other proteins in same PDB: d1gwca2, d1gwcb2, d1gwcc2 |
PDB Entry: 1gwc (more details), 2.25 Å
SCOP Domain Sequences for d1gwca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Wheat (Triticum tauschii l.)}
llpadpyeraiarfwvayvddklvapwrqwlrgkteeeksegkkqafaavgvlegalrec
skgggffggdgvglvdvalggvlswmkvtealsgdkifdaaktpllaawverfieldaak
aalpdvgrllefakarea
Timeline for d1gwca1:
View in 3DDomains from other chains: (mouse over for more information) d1gwcb1, d1gwcb2, d1gwcc1, d1gwcc2 |