SCOPe 2.08: Domain d1gwca1: 1gwc A:87-224

Lineage for d1gwca1 (1gwc A:87-224)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class tau GST [81354] (2 species)

7. Species Aegilops tauschii, also known as Triticum tauschii [TaxId:37682] [74726] (1 PDB entry)

8. Domain d1gwca1: 1gwc A:87-224 [70660]
   Other proteins in same PDB: d1gwca2, d1gwcb2, d1gwcc2
   complexed with gtx, so4

Details for d1gwca1

PDB Entry: 1gwc, 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

PDB Compounds: (A:) glutathione s-transferase tsi-1

SCOPe Domain Sequences for d1gwca1:

Sequence; same for both SEQRES and ATOM records:

>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}
llpadpyeraiarfwvayvddklvapwrqwlrgkteeeksegkkqafaavgvlegalrec
skgggffggdgvglvdvalggvlswmkvtealsgdkifdaaktpllaawverfieldaak
aalpdvgrllefakarea

Timeline for d1gwca1:

• d1gwca1 first appeared in SCOP 1.61
  
• d1gwca1 appears in SCOPe 2.07