![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
![]() | Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
![]() | Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) |
![]() | Protein p3 shell [69996] (1 species) |
![]() | Species Bacteriophage PRD1 [TaxId:10658] [69997] (5 PDB entries) |
![]() | Domain d1gw8f_: 1gw8 F: [70651] mutant |
PDB Entry: 1gw8 (more details), 13.3 Å
SCOPe Domain Sequences for d1gw8f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw8f_ i.6.1.1 (F:) p3 shell {Bacteriophage PRD1 [TaxId: 10658]} alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplid lstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanf sdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarl lmgyeyftsrte
Timeline for d1gw8f_: