Lineage for d1gu0i_ (1gu0 I:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241625Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 241626Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 241627Protein Type II 3-dehydroquinate dehydratase [52306] (3 species)
  7. 241656Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 241701Domain d1gu0i_: 1gu0 I: [70559]

Details for d1gu0i_

PDB Entry: 1gu0 (more details), 2 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor

SCOP Domain Sequences for d1gu0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu0i_ c.23.13.1 (I:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1gu0i_:

Click to download the PDB-style file with coordinates for d1gu0i_.
(The format of our PDB-style files is described here.)

Timeline for d1gu0i_: