Lineage for d1gtfg_ (1gtf G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559779Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 1559780Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
    automatically mapped to Pfam PF02081
  6. 1559781Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 1559782Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)
  8. 1559789Domain d1gtfg_: 1gtf G: [70466]
    protein/RNA complex; complexed with trp

Details for d1gtfg_

PDB Entry: 1gtf (more details), 1.75 Å

PDB Description: the structure of the trp rna-binding attenuation protein (trap) bound to a 53-nucleotide rna molecule containing gaguu repeats
PDB Compounds: (G:) trp RNA-binding attenuation protein (trap)

SCOPe Domain Sequences for d1gtfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtfg_ b.82.5.1 (G:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
nsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqt
rhgviesegk

SCOPe Domain Coordinates for d1gtfg_:

Click to download the PDB-style file with coordinates for d1gtfg_.
(The format of our PDB-style files is described here.)

Timeline for d1gtfg_: