Lineage for d1grwd_ (1grw D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523399Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 1523488Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 1523489Protein Major sperm protein, MSP [49361] (2 species)
  7. 1523490Species Nematode (Caenorhabditis elegans) [TaxId:6239] [74862] (1 PDB entry)
  8. 1523494Domain d1grwd_: 1grw D: [70394]

Details for d1grwd_

PDB Entry: 1grw (more details), 2.6 Å

PDB Description: c. elegans major sperm protein
PDB Compounds: (D:) major sperm protein 31/40/142

SCOPe Domain Sequences for d1grwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grwd_ b.1.11.2 (D:) Major sperm protein, MSP {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
eynp

SCOPe Domain Coordinates for d1grwd_:

Click to download the PDB-style file with coordinates for d1grwd_.
(The format of our PDB-style files is described here.)

Timeline for d1grwd_: