Lineage for d1grkb_ (1grk B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily) Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) 
Family c.117.1.1: Amidase signature (AS) enzymes [75305] (1 protein) Protein Malonamidase E2 [75306] (1 species) Species Bradyrhizobium japonicum [TaxId:375] [75307] (3 PDB entries) 
Domain d1grkb_: 1grk B: [70390]
Details for d1grkb_
PDB Entry: 1grk (more details), 1.9 Å
PDB Description: the crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum
SCOP Domain Sequences for d1grkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grkb_ c.117.1.1 (B:) Malonamidase E2 {Bradyrhizobium japonicum}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak
SCOP Domain Coordinates for d1grkb_:
Click to download the PDB-style file with coordinates for d1grkb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1grkb_:
- d1grkb_ is new in SCOP 1.61
- d1grkb_ last appears in SCOP 1.63
View in 3D
