Lineage for d1gr8b_ (1gr8 B:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the restSuperfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) 
Family c.117.1.1: Amidase signature (AS) enzymes [75305] (3 proteins) 
Protein Malonamidase E2 [75306] (1 species) Species Bradyrhizobium japonicum [TaxId:375] [75307] (3 PDB entries) 
Domain d1gr8b_: 1gr8 B: [70386]
Details for d1gr8b_
PDB Entry: 1gr8 (more details), 1.8 Å
PDB Description: the crystal structure of malonamidase e2 from bradyrhizobium japonicum
SCOP Domain Sequences for d1gr8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gr8b_ c.117.1.1 (B:) Malonamidase E2 {Bradyrhizobium japonicum}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak
SCOP Domain Coordinates for d1gr8b_:
Click to download the PDB-style file with coordinates for d1gr8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gr8b_:
- d1gr8b_ first appeared in SCOP 1.61
- d1gr8b_ does not appear in SCOP 1.65
View in 3D
