Lineage for d1gr0a2 (1gr0 A:201-311)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568642Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2568724Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2568755Species Mycobacterium tuberculosis [TaxId:1773] [75485] (1 PDB entry)
  8. 2568756Domain d1gr0a2: 1gr0 A:201-311 [70380]
    Other proteins in same PDB: d1gr0a1
    complexed with cac, nad, zn

Details for d1gr0a2

PDB Entry: 1gr0 (more details), 1.95 Å

PDB Description: myo-inositol 1-phosphate synthase from mycobacterium tuberculosis in complex with nad and zinc.
PDB Compounds: (A:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1gr0a2:

Sequence, based on SEQRES records: (download)

>d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]}
qvgatithrvlaklfedrgvqldrtmqlnvggnmdflnmlererleskkisktqavtsnl
krefktkdvhigpsdhvgwlddrkwayvrlegrafgdvplnleyklevwds

Sequence, based on observed residues (ATOM records): (download)

>d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]}
qvgatithrvlaklfedrgvqldrtmqlnvggnmdflnmledvhigpsdhvgwlddrkwa
yvrlegrafgdvplnleyklevwds

SCOPe Domain Coordinates for d1gr0a2:

Click to download the PDB-style file with coordinates for d1gr0a2.
(The format of our PDB-style files is described here.)

Timeline for d1gr0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gr0a1