Lineage for d1gq2m2 (1gq2 M:23-279)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498325Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 2498332Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 2498333Species Domestic pigeon (Columba livia) [TaxId:8932] [75253] (1 PDB entry)
  8. 2498346Domain d1gq2m2: 1gq2 M:23-279 [70333]
    Other proteins in same PDB: d1gq2a1, d1gq2b1, d1gq2c1, d1gq2d1, d1gq2e1, d1gq2f1, d1gq2g1, d1gq2h1, d1gq2i1, d1gq2j1, d1gq2k1, d1gq2l1, d1gq2m1, d1gq2n1, d1gq2o1, d1gq2p1
    complexed with cl, mn, na, nap, oxl

Details for d1gq2m2

PDB Entry: 1gq2 (more details), 2.5 Å

PDB Description: malic enzyme from pigeon liver
PDB Compounds: (M:) malic enzyme

SCOPe Domain Sequences for d1gq2m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq2m2 c.58.1.3 (M:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]}
kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
frllhkyrnkyctfndd

SCOPe Domain Coordinates for d1gq2m2:

Click to download the PDB-style file with coordinates for d1gq2m2.
(The format of our PDB-style files is described here.)

Timeline for d1gq2m2: