Lineage for d1gkcb_ (1gkc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964375Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2964376Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)
  8. 2964389Domain d1gkcb_: 1gkc B: [70216]
    complexed with ca, nfh, zn

Details for d1gkcb_

PDB Entry: 1gkc (more details), 2.3 Å

PDB Description: mmp9-inhibitor complex
PDB Compounds: (B:) 92 kda type IV collagenase

SCOPe Domain Sequences for d1gkcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkcb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv
aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahefghal
gldhssvpealmypmyrftegpplhkddvngirhly

SCOPe Domain Coordinates for d1gkcb_:

Click to download the PDB-style file with coordinates for d1gkcb_.
(The format of our PDB-style files is described here.)

Timeline for d1gkcb_: