Lineage for d1gkcb_ (1gkc B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) 
Protein Gelatinase B (MMP-9) [75496] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75497] (3 PDB entries) 
Domain d1gkcb_: 1gkc B: [70216]
Details for d1gkcb_
PDB Entry: 1gkc (more details), 2.3 Å
PDB Description: mmp9-inhibitor complex
SCOP Domain Sequences for d1gkcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkcb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens)}
dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv
aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahefghal
gldhssvpealmypmyrftegpplhkddvngirhly
SCOP Domain Coordinates for d1gkcb_:
Click to download the PDB-style file with coordinates for d1gkcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gkcb_:
- d1gkcb_ is new in SCOP 1.61
- d1gkcb_ appears in SCOP 1.63
- d1gkcb_ appears in the current release, SCOPe 2.08
View in 3D
