![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) ![]() |
![]() | Family h.1.20.1: Intermediate filament protein, coiled coil region [64594] (3 proteins) C-terminal part of Pfam PF00038 |
![]() | Protein Vimentin coil [64595] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64596] (3 PDB entries) |
![]() | Domain d1gk4d_: 1gk4 D: [70206] coil 2B fragment complexed with act |
PDB Entry: 1gk4 (more details), 2.3 Å
SCOPe Domain Sequences for d1gk4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gk4d_ h.1.20.1 (D:) Vimentin coil {Human (Homo sapiens) [TaxId: 9606]} vdalkgtneslerqmremeenfaveaanyqdtigrlqdeiqnmkeemarhlreyqdllnv kmaldieiatyrkllege
Timeline for d1gk4d_: