Lineage for d1gk4b_ (1gk4 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969309Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) (S)
  5. 1969310Family h.1.20.1: Intermediate filament protein, coiled coil region [64594] (3 proteins)
    C-terminal part of Pfam PF00038
  6. 1969314Protein Vimentin coil [64595] (1 species)
  7. 1969315Species Human (Homo sapiens) [TaxId:9606] [64596] (3 PDB entries)
  8. 1969320Domain d1gk4b_: 1gk4 B: [70204]
    coil 2B fragment
    complexed with act

Details for d1gk4b_

PDB Entry: 1gk4 (more details), 2.3 Å

PDB Description: human vimentin coil 2b fragment (cys2)
PDB Compounds: (B:) vimentin

SCOPe Domain Sequences for d1gk4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk4b_ h.1.20.1 (B:) Vimentin coil {Human (Homo sapiens) [TaxId: 9606]}
cevdalkgtneslerqmremeenfaveaanyqdtigrlqdeiqnmkeemarhlreyqdll
nvkmaldieiatyrklleg

SCOPe Domain Coordinates for d1gk4b_:

Click to download the PDB-style file with coordinates for d1gk4b_.
(The format of our PDB-style files is described here.)

Timeline for d1gk4b_: