SCOPe 2.07: Domain d1gjqa1: 1gjq A:3-117

Lineage for d1gjqa1 (1gjq A:3-117)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)

8. Domain d1gjqa1: 1gjq A:3-117 [70193]
   Other proteins in same PDB: d1gjqa2, d1gjqb2
   complexed with cyn, dhe, hec

Details for d1gjqa1

PDB Entry: 1gjq, 2.7 Å

PDB Description: pseudomonas aeruginosa cd1 nitrite reductase reduced cyanide complex

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1gjqa1:

Sequence; same for both SEQRES and ATOM records:

>d1gjqa1 a.3.1.2 (A:3-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
dmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkp
ltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

Timeline for d1gjqa1:

• d1gjqa1 first appeared in SCOP 1.61
  
• d1gjqa1 appears in SCOPe 2.06
  
• d1gjqa1 appears in the current release, SCOPe 2.08