Lineage for d1eakd2 (1eak D:108-216,D:394-450)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205690Protein Gelatinase A [55534] (1 species)
  7. 2205691Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries)
  8. 2205696Domain d1eakd2: 1eak D:108-216,D:394-450 [70109]
    Other proteins in same PDB: d1eaka1, d1eaka3, d1eaka4, d1eaka5, d1eakb1, d1eakb3, d1eakb4, d1eakb5, d1eakc1, d1eakc3, d1eakc4, d1eakc5, d1eakd1, d1eakd3, d1eakd4, d1eakd5
    complexed with ca, so4, zn; mutant

Details for d1eakd2

PDB Entry: 1eak (more details), 2.66 Å

PDB Description: catalytic domain of prommp-2 e404q mutant
PDB Compounds: (D:) 72 kda type IV collagenase

SCOPe Domain Sequences for d1eakd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eakd2 d.92.1.11 (D:108-216,D:394-450) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]}
anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea
diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah
qfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd

SCOPe Domain Coordinates for d1eakd2:

Click to download the PDB-style file with coordinates for d1eakd2.
(The format of our PDB-style files is described here.)

Timeline for d1eakd2: