Lineage for d1eakb4 (1eak B:278-335)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203830Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 203831Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 203907Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
  6. 203916Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
  7. 203917Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)
  8. 203922Domain d1eakb4: 1eak B:278-335 [70101]
    Other proteins in same PDB: d1eaka1, d1eaka2, d1eakb1, d1eakb2, d1eakc1, d1eakc2, d1eakd1, d1eakd2

Details for d1eakb4

PDB Entry: 1eak (more details), 2.66 Å

PDB Description: catalytic domain of prommp-2 e404q mutant

SCOP Domain Sequences for d1eakb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eakb4 g.14.1.2 (B:278-335) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)}
alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpet

SCOP Domain Coordinates for d1eakb4:

Click to download the PDB-style file with coordinates for d1eakb4.
(The format of our PDB-style files is described here.)

Timeline for d1eakb4: