Lineage for d1eakb2 (1eak B:108-216,B:394-450)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1918054Protein Gelatinase A [55534] (1 species)
  7. 1918055Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries)
  8. 1918058Domain d1eakb2: 1eak B:108-216,B:394-450 [70099]
    Other proteins in same PDB: d1eaka1, d1eaka3, d1eaka4, d1eaka5, d1eakb1, d1eakb3, d1eakb4, d1eakb5, d1eakc1, d1eakc3, d1eakc4, d1eakc5, d1eakd1, d1eakd3, d1eakd4, d1eakd5
    complexed with ca, so4, zn; mutant

Details for d1eakb2

PDB Entry: 1eak (more details), 2.66 Å

PDB Description: catalytic domain of prommp-2 e404q mutant
PDB Compounds: (B:) 72 kda type IV collagenase

SCOPe Domain Sequences for d1eakb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eakb2 d.92.1.11 (B:108-216,B:394-450) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]}
anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea
diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah
qfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd

SCOPe Domain Coordinates for d1eakb2:

Click to download the PDB-style file with coordinates for d1eakb2.
(The format of our PDB-style files is described here.)

Timeline for d1eakb2: