Lineage for d1ck1a2 (1ck1 A:122-239)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018752Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1018753Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1018802Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1018803Species Staphylococcus aureus [TaxId:1280] [54345] (11 PDB entries)
    Uniprot P23313
  8. 1018808Domain d1ck1a2: 1ck1 A:122-239 [70068]
    Other proteins in same PDB: d1ck1a1
    complexed with zn

Details for d1ck1a2

PDB Entry: 1ck1 (more details), 2.6 Å

PDB Description: structure of staphylococcal enterotoxin c3
PDB Compounds: (A:) protein (enterotoxin type c-3)

SCOPe Domain Sequences for d1ck1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck1a2 d.15.6.1 (A:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng

SCOPe Domain Coordinates for d1ck1a2:

Click to download the PDB-style file with coordinates for d1ck1a2.
(The format of our PDB-style files is described here.)

Timeline for d1ck1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ck1a1