SCOPe 2.01: Domain d1kx7a_: 1kx7 A:

Lineage for d1kx7a_ (1kx7 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mono-heme c-type cytochrome ScyA [68948] (1 species)

7. Species Shewanella putrefaciens [TaxId:24] [68949] (2 PDB entries)

8. Domain d1kx7a_: 1kx7 A: [68880]
   complexed with hec

Details for d1kx7a_

PDB Entry: 1kx7

PDB Description: family of 30 conformers of a mono-heme ferrocytochrome c from shewanella putrefaciens solved by nmr

PDB Compounds: (A:) mono-heme c-type cytochrome ScyA

SCOPe Domain Sequences for d1kx7a_:

Sequence; same for both SEQRES and ATOM records:

>d1kx7a_ a.3.1.1 (A:) Mono-heme c-type cytochrome ScyA {Shewanella putrefaciens [TaxId: 24]}
adlqdaeaiynkactvchsmgvagapkshntadweprlakgvdnlvksvktglnamppgg
mctdctdedykaaiefmskak

Timeline for d1kx7a_:

• d1kx7a_ first appeared in SCOP 1.59
  
• d1kx7a_ appears in SCOP 1.75
  
• d1kx7a_ appears in SCOPe 2.02
  
• d1kx7a_ appears in the current release, SCOPe 2.08, called d1kx7a1