Lineage for d1kx2a_ (1kx2 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257170Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1257483Protein Mono-heme c-type cytochrome ScyA [68948] (1 species)
  7. 1257484Species Shewanella putrefaciens [TaxId:24] [68949] (2 PDB entries)
  8. 1257486Domain d1kx2a_: 1kx2 A: [68878]
    complexed with hec

Details for d1kx2a_

PDB Entry: 1kx2 (more details)

PDB Description: minimized average structure of a mono-heme ferrocytochrome c from shewanella putrefaciens
PDB Compounds: (A:) mono-heme c-type cytochrome ScyA

SCOPe Domain Sequences for d1kx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx2a_ a.3.1.1 (A:) Mono-heme c-type cytochrome ScyA {Shewanella putrefaciens [TaxId: 24]}
adlqdaeaiynkactvchsmgvagapkshntadweprlakgvdnlvksvktglnamppgg
mctdctdedykaaiefmskak

SCOPe Domain Coordinates for d1kx2a_:

Click to download the PDB-style file with coordinates for d1kx2a_.
(The format of our PDB-style files is described here.)

Timeline for d1kx2a_: