Lineage for d1kx2a_ (1kx2 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760910Protein Mono-heme c-type cytochrome ScyA [68948] (1 species)
  7. 760911Species Shewanella putrefaciens [TaxId:24] [68949] (2 PDB entries)
  8. 760913Domain d1kx2a_: 1kx2 A: [68878]
    complexed with hec

Details for d1kx2a_

PDB Entry: 1kx2 (more details)

PDB Description: minimized average structure of a mono-heme ferrocytochrome c from shewanella putrefaciens
PDB Compounds: (A:) mono-heme c-type cytochrome ScyA

SCOP Domain Sequences for d1kx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx2a_ a.3.1.1 (A:) Mono-heme c-type cytochrome ScyA {Shewanella putrefaciens [TaxId: 24]}
adlqdaeaiynkactvchsmgvagapkshntadweprlakgvdnlvksvktglnamppgg
mctdctdedykaaiefmskak

SCOP Domain Coordinates for d1kx2a_:

Click to download the PDB-style file with coordinates for d1kx2a_.
(The format of our PDB-style files is described here.)

Timeline for d1kx2a_: