Lineage for d1kqha_ (1kqh A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889127Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 889168Family g.3.6.2: Spider toxins [57072] (25 proteins)
  6. 889169Protein ACTX-HI:OB4219 [69926] (1 species)
  7. 889170Species Funnel-web spider (Hadronyche infensa) [TaxId:153481] [69927] (2 PDB entries)
  8. 889171Domain d1kqha_: 1kqh A: [68810]

Details for d1kqha_

PDB Entry: 1kqh (more details)

PDB Description: nmr solution structure of the cis pro30 isomer of actx-hi:ob4219
PDB Compounds: (A:) ACTX-Hi:OB4219

SCOP Domain Sequences for d1kqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqha_ g.3.6.2 (A:) ACTX-HI:OB4219 {Funnel-web spider (Hadronyche infensa) [TaxId: 153481]}
kclaeaadcspwsgdscckpylcsciffypcscrpkgw

SCOP Domain Coordinates for d1kqha_:

Click to download the PDB-style file with coordinates for d1kqha_.
(The format of our PDB-style files is described here.)

Timeline for d1kqha_: