PDB entry 1kqh

View 1kqh on RCSB PDB site
Description: NMR Solution Structure of the cis Pro30 Isomer of ACTX-Hi:OB4219
Class: toxin
Keywords: Hadronyche infensa, funnel web, spider venom, cis-trans isomerisation, disulfide rich, cystine knot, solution structure, NMR spectroscopy
Deposited on 2002-01-05, released 2002-02-06
The last revision prior to the SCOP 1.75 freeze date was dated 2002-10-16, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ACTX-Hi:OB4219
  Species: Hadronyche infensa
  Domains in SCOP 1.75: d1kqha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kqhA (A:)
  kclaeaadcspwsgdscckpylcsciffypcscrpkgw